Vol. 12, Issue 3, Part A (2025)

Author(s): Venkatajothi Ramarao, M Mohamed Mahroop Raja and Vijayalakshmi Kandasamy

Abstract: Pharmaceuticals that employ peptides, or short chains of amino acids, as therapeutic agents are known as peptide-based drugs. These drugs offer a fresh method of treating a range of illnesses by mimicking or blocking the actions of natural proteins, hormones, or enzymes. Human, animal, and bird infections are spread by Culex quinquefasciatus. Humans suffer from a number of severe health problems as a result. The effectiveness of the peptide derived from Boerhavia diffusa against Culex quinquefasciatus was determined in this investigation. We use insilico techniques to analyse the new peptide's insecticidal characteristics. Protein-peptide docking investigations using automated insilico methods were part of the study's methodology. Using sophisticated 3D macromolecular visualization tools, all of the data were explained. The effectiveness of the new peptide against Culex quinquefasciatus's cytochrome P450 CYP6Z8 was amply demonstrated by the full docking data. The new peptide (SFQALLERIYFHVKIEYLVKVLTKNCRIILWLFKDPFTHYIRYQGKSILS) was ultimately found to have superior inhibitory activity against Culex quinquefasciatus. As a result, the de novo peptide functions as a possible treatment for Culex quinquefasciatus.

DOI: 10.22271/23487941.2025.v12.i3a.838