Red Paper
CONTACT: +91-9711224068
International Journal of Mosquito Research
  • Printed Journal
  • Indexed Journal
  • Refereed Journal
  • Peer Reviewed Journal

Impact Factor (RJIF): 5.82

Peer Reviewed Journal

Vol. 12, Issue 3, Part A (2025)

Discovery of a de novo medicine derived from peptide against Culex quinquefasciatus using computational protocols

Author(s): Venkatajothi Ramarao, M Mohamed Mahroop Raja and Vijayalakshmi Kandasamy
Abstract: Pharmaceuticals that employ peptides, or short chains of amino acids, as therapeutic agents are known as peptide-based drugs. These drugs offer a fresh method of treating a range of illnesses by mimicking or blocking the actions of natural proteins, hormones, or enzymes. Human, animal, and bird infections are spread by Culex quinquefasciatus. Humans suffer from a number of severe health problems as a result. The effectiveness of the peptide derived from Boerhavia diffusa against Culex quinquefasciatus was determined in this investigation. We use insilico techniques to analyse the new peptide's insecticidal characteristics. Protein-peptide docking investigations using automated insilico methods were part of the study's methodology. Using sophisticated 3D macromolecular visualization tools, all of the data were explained. The effectiveness of the new peptide against Culex quinquefasciatus's cytochrome P450 CYP6Z8 was amply demonstrated by the full docking data. The new peptide (SFQALLERIYFHVKIEYLVKVLTKNCRIILWLFKDPFTHYIRYQGKSILS) was ultimately found to have superior inhibitory activity against Culex quinquefasciatus. As a result, the de novo peptide functions as a possible treatment for Culex quinquefasciatus.
Pages: 32-36  |  1204 Views  484 Downloads


International Journal of Mosquito Research
How to cite this article:
Venkatajothi Ramarao, M Mohamed Mahroop Raja, Vijayalakshmi Kandasamy. Discovery of a de novo medicine derived from peptide against Culex quinquefasciatus using computational protocols. Int J Mosq Res 2025;12(3):32-36. DOI: https://doi.org/10.22271/23487941.2025.v12.i3a.838
International Journal of Mosquito Research

International Journal of Mosquito Research

International Journal of Mosquito Research
Call for book chapter