Red Paper
CONTACT: +91-9711224068
International Journal of Mosquito Research
  • Printed Journal
  • Indexed Journal
  • Refereed Journal
  • Peer Reviewed Journal

Impact Factor (RJIF): 5.82

Peer Reviewed Journal

Vol. 12, Issue 3, Part A (2025)

Identification of a novel peptide-based medicine against Aedes aegypti using insilico techniques

Author(s): Venkatajothi Ramarao, Selvam Periaswamy and Madhu Bala Selvam
Abstract: Peptide-based medications are pharmaceuticals that use peptides, or short amino acid chains, as medicinal agents. These medications can be developed to replicate or inhibit the activities of natural proteins, hormones, or enzymes, providing a novel approach to treating a variety of disorders. Aedes aegypti is known to spread diseases by acting as a vector for Yellow fever virus, dengue virus, chikungunya virus, and Zika virus. In this research study, we found out the efficiency of the peptide obtained from Boerhavia diffusa against Aedes aegypti. We analyse the insecticidal properties of the novel peptide using Insilico protocols. The methodology of this study involved protein-peptide docking studies using automated insilico tools. All the results were elucidated using advanced 3D macromolecular visualization tools. The complete docking results clearly elucidated the efficiency of the novel peptide against cytochrome P450 CYP6Z8 of Aedes aegypti. It was finally concluded that the novel peptide (SFQALLERIYFHVKIEYLVKVLTKNCRIILWLFKDPFTHYIRYQGKSILS) had better inhibitive action on Aedes aegypti. Hence, the de novo peptide acts as a potential therapeutic agent against Aedes aegypti.
Pages: 27-31  |  1794 Views  781 Downloads


International Journal of Mosquito Research
How to cite this article:
Venkatajothi Ramarao, Selvam Periaswamy, Madhu Bala Selvam. Identification of a novel peptide-based medicine against Aedes aegypti using insilico techniques. Int J Mosq Res 2025;12(3):27-31. DOI: https://doi.org/10.22271/23487941.2025.v12.i3a.837
International Journal of Mosquito Research

International Journal of Mosquito Research

International Journal of Mosquito Research
Call for book chapter